PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast08G060500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family VOZ
Protein Properties Length: 598aa    MW: 65345.2 Da    PI: 4.975
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast08G060500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ416.93.4e-1282644811217
                 VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalne.glpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspw 90 
                         p+ps++lgpkcalwdc rp++gse++qdyc+ +ha laln+ gl gt+pv+rp+gidlkdg+lf+al akvqgk+vgip+cegaat+kspw
  Brast08G060500.1.p 264 PSPSQYLGPKCALWDCGRPVRGSEECQDYCNPYHAGLALNDdGLQGTRPVMRPRGIDLKDGPLFDALCAKVQGKNVGIPVCEGAATSKSPW 354
                         89**************************************9799*********************************************** PP

                 VOZ  91 naaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldala 181
                         na+elfdlsllege++rewlffd+prrafesgnrkqrslpdy grgwhesrkqvmk+fgglk+syymdpqpss++ewhl+eyein+++ala
  Brast08G060500.1.p 355 NAPELFDLSLLEGESLREWLFFDRPRRAFESGNRKQRSLPDYGGRGWHESRKQVMKDFGGLKKSYYMDPQPSSNYEWHLFEYEINDSNALA 445
                         ******************************************************************************************* PP

                 VOZ 182 lyrlelklvdekksakgkvskdsladlqkklgrlta 217
                         lyrle+k++d+k+s+k+k++++sl+++q+++++l+a
  Brast08G060500.1.p 446 LYRLEFKSSDAKRSVKSKLASSSLNEIQQQMVKLSA 481
                         **********************************87 PP

Sequence ? help Back to Top
Protein Sequence    Length: 598 aa     Download sequence    Send to blast
MAGDPSGCAG AGGGSRTGKS PRSSSRQFRD RAKTRVDDLQ EIFSGLQSAR KESRSADAAV  60
LEEQVHQMLR EWRAELNVAS PASSLQNSQG NNRALSDPPS ETLRMLQLAV EEEDDATSKL  120
MAPRSPSVMQ PSRQTHGIGQ NDHNLNPDLQ VQAGAVAEGA AALQQSLGEG MQGDCAGEVA  180
DIANALFQDQ MYYIDHELSI DDFLHGSNPD SLSNLQGIGL LEHQQFNLPL DLEPPNSYAD  240
ANNSVQNTGD VLFHMSDLLT TMCPSPSQYL GPKCALWDCG RPVRGSEECQ DYCNPYHAGL  300
ALNDDGLQGT RPVMRPRGID LKDGPLFDAL CAKVQGKNVG IPVCEGAATS KSPWNAPELF  360
DLSLLEGESL REWLFFDRPR RAFESGNRKQ RSLPDYGGRG WHESRKQVMK DFGGLKKSYY  420
MDPQPSSNYE WHLFEYEIND SNALALYRLE FKSSDAKRSV KSKLASSSLN EIQQQMVKLS  480
ADSPGDNKRA ARSKTKANQK DSNGNTYPAL NVPNQASASS AYETVALNIP KQASASNAYE  540
TASLNIPNQA NTSNAYQEVS QVDEMAFLNE NVMYGPHLPY GYPAEKGHFH WNPSDGA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3762940.0AK376294.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3120B09.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568104.10.0PREDICTED: transcription factor VOZ1-like
TrEMBLI1HHM20.0I1HHM2_BRADI; Uncharacterized protein
STRINGBRADI2G19820.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23433888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-146vascular plant one zinc finger protein